Thymosin Alpha-1
Thymosin Alpha-1
Strength
Research this compound
For research use only. Not for human consumption.
Identity, storage, and what ships.
The technical record. Identity rows reflect literature-cited values for this compound; storage rows describe the conditions under which Nexara holds and ships the lyophilized form.
Identity
- Appearance
- White to off-white lyophilized powder
- Molecular Formula
- C129H215N33O55
- Molecular Weight
- 3108.3 g/mol
- CAS Number
- 62304-98-7
- Sequence
- Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn
- Synonyms
- Thymalfasin, Thymosin α1, TA1, Tα1, Zadaxin (research reference name)
- Purity
- ≥99%
Storage profile
- Storage (Lyophilized)
- -20C
- Storage (Reconstituted)
- 2-8C
- Shelf Life (Lyophilized)
- 24 months
- Shelf Life (Reconstituted)
- Use within 30 days
- Reconstitution
- Bacteriostatic water
- Handling
- Protect from light and minimize freeze-thaw cycles. For laboratory research use only.
Shipment
- —1× vial (5 mg)
- —Storage and handling instructions
Studied research areas.
Each item below names a domain in which Thymosin Alpha-1 has been investigated in published research. Listed for context — not as a use recommendation.
- 01T-cell maturation and lymphocyte differentiation research
- 02Toll-like receptor (TLR) signaling and innate immune pathway studies
- 03Cytokine and interferon expression research in cell-culture models
- 04Dendritic-cell function and antigen-presentation research
- 05Immunomodulation research in preclinical host-defense models
- 06Natural killer (NK) cell activity research
Held to research-grade quality standards.
Every batch is held to research-grade quality standards before it ships. Each vial is labeled with its batch identifier so that fulfillment can be traced through the order record. For our research-use-only posture, see the Research Compliance page.
Common questions for Thymosin Alpha-1.
For research use only. Not for human consumption.
These products are not intended to diagnose, treat, cure, or prevent any disease. They are sold strictly as research chemicals for laboratory use.
Fulfillment: Orders ship from Texas via USPS within 2 weeks of payment confirmation. You'll receive tracking by email when your package leaves our facility.
Researcher reviews
Reviews open as orders are delivered.
Only researchers who've received an order of this compound can submit a review. Submitted text is screened for compliant language before publication. No anonymous testimonials, no AI-generated copy.
Pending researcher reviews
Reviews appear here as researchers complete and verify orders.
If you've received this compound and would like to leave a review, the option appears in your account dashboard once your order ships.
Reference reading on Thymosin Alpha-1 and adjacent topics.
- 5 min
Compound profile
Thymosin Alpha-1: Compound Profile
A research profile of Thymosin Alpha-1 (thymalfasin), the synthetic 28-residue N-acetylated peptide derived from prothymosin alpha: identity, the Toll-like-receptor and immune-cell-signaling pathways its preclinical literature studies, and its place among thymic immune peptides.
- 3 min
Growth-Hormone Secretagogues & GHRH Analogs: A Research Overview
CJC-1295 vs Ipamorelin: How Two GH Secretagogues Differ
CJC-1295 and Ipamorelin act on different receptors, GHRH vs ghrelin/GHS-R. A research comparison of their mechanisms, release kinetics, and why the literature pairs them.
- 6 min
What ≥99% Purity Actually Means: HPLC Explained
Why ≥99% and not 98%: a practical comparison
A side-by-side look at what ≥99% and 98% peptide purity actually mean in research practice: the impurity load step-change, application sensitivity, and why the working threshold sits where it does.
Related Research Products
KPV
10 mg · Immune
KPV
10 mg
KPV is a tripeptide fragment derived from the alpha-melanocyte stimulating hormone (α-MSH) peptide sequence. In labor...
Chonluten
20 mg · Immune
Chonluten
20 mg
Chonluten is a synthetic tripeptide (Glu-Asp-Gly) that has been the subject of research into respiratory tissue gene...
LL-37
5 mg · Immune
LL-37
5 mg
LL-37 is a synthetic 37-residue cationic antimicrobial peptide ([LL-37, 37 aa]), the sole huma...
Thymalin
10 mg · Immune
Thymalin
10 mg
Thymalin is a thymus-derived polypeptide fraction that has been the subject of research into thymic peptide signaling...