
Chonluten
Chonluten
Research this compound
For research use only. Not for human consumption.
Identity, storage, and what ships.
The technical record. Identity rows reflect literature-cited values for this compound; storage rows describe the conditions under which Nexara holds and ships the lyophilized form.
Identity
- Appearance
- White lyophilized powder
- Molecular Formula
- C11H17N3O8
- Molecular Weight
- 319.27 g/mol
- CAS Number
- 75007-24-8
- Sequence
- Glu-Asp-Gly
- Synonyms
- T-34, Tripeptide T-34, Glutamyl-Aspartyl-Glycine, H-Glu-Asp-Gly-OH, Lung Peptide Bioregulator
- Purity
- ≥99%
Storage profile
- Storage (Lyophilized)
- -20C
- Storage (Reconstituted)
- 2-8C
- Shelf Life (Lyophilized)
- 24 months
- Shelf Life (Reconstituted)
- Use within 30 days
- Reconstitution
- Bacteriostatic water
- Handling
- Protect from light and minimize freeze-thaw cycles. For laboratory research use only.
Shipment
- —1× vial (20 mg)
- —Storage and handling instructions
Studied research areas.
Each item below names a domain in which Chonluten has been investigated in published research. Listed for context — not as a use recommendation.
- 01Respiratory and bronchial epithelial tissue gene-expression research
- 02Peptide bioregulator signaling pathway investigation in preclinical models
- 03Cellular proliferation and differentiation research in lung-tissue models
- 04Short-peptide structure-activity relationship studies
- 05Aging-related cellular models of respiratory tissue in research settings
- 06Comparative bioregulator peptide characterization research
Held to research-grade quality standards.
Every batch is held to research-grade quality standards before it ships. Each vial is labeled with its batch identifier so that fulfillment can be traced through the order record. For our research-use-only posture, see the Research Compliance page.
Common questions for Chonluten.
For research use only. Not for human consumption.
These products are not intended to diagnose, treat, cure, or prevent any disease. They are sold strictly as research chemicals for laboratory use.
Fulfillment: Orders ship from Texas via USPS within 2 weeks of payment confirmation. You'll receive tracking by email when your package leaves our facility.
Researcher reviews
Reviews open as orders are delivered.
Only researchers who've received an order of this compound can submit a review. Submitted text is screened for compliant language before publication. No anonymous testimonials, no AI-generated copy.
Pending researcher reviews
Reviews appear here as researchers complete and verify orders.
If you've received this compound and would like to leave a review, the option appears in your account dashboard once your order ships.
Reference reading on Chonluten and adjacent topics.
- 4 min
Foundational
Mitochondrial-Targeted Peptides: A Research Overview
How the mitochondrial peptide class is studied: SS-31, a cardiolipin-targeting tetrapeptide, and MOTS-c, a mitochondrial-derived signaling peptide — two distinct routes to the same organelle.
- 6 min
Lyophilization and Reconstitution: A Research Primer
Lyophilization-induced aggregation: how to recognize it
How aggregation arises during the lyophilization process, what it does to a peptide's functional behavior on reconstitution, and the visual and analytical signals that flag it.
- 5 min
Mass Spectrometry, HPLC, and LAL Endotoxin Testing
LAL vs. rFC endotoxin testing
How the Limulus Amebocyte Lysate assay and recombinant Factor C compare: what each measures, why the results are interchangeable in EU/mg, and the practical reasons rFC adoption is growing.
Related Research Products

KPV
10 mg · Immune
KPV
10 mg
KPV is a tripeptide fragment derived from the alpha-melanocyte stimulating hormone (α-MSH) peptide sequence. In labor...

LL-37
5 mg · Immune
LL-37
5 mg
LL-37 is a synthetic 37-residue cationic antimicrobial peptide ([LL-37, 37 aa]), the sole huma...

Thymalin
10 mg · Immune
Thymalin
10 mg
Thymalin is a thymus-derived polypeptide fraction that has been the subject of research into thymic peptide signaling...

Thymosin Alpha-1
5 mg · Immune
Thymosin Alpha-1
5 mg
Thymosin Alpha-1 is a synthetic 28-amino-acid, N-terminally acetylated peptide (Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN) that...