Thymalin
Thymalin
Research this compound
For research use only. Not for human consumption.
Identity, storage, and what ships.
The technical record. Identity rows reflect literature-cited values for this compound; storage rows describe the conditions under which Nexara holds and ships the lyophilized form.
Identity
- Appearance
- White to off-white lyophilized powder
- CAS Number
- 79621-14-0
- Synonyms
- Thymalin, Thymus polypeptide fraction, Bovine thymus polypeptide extract, Thymic peptide complex
- Purity
- ≥99%
Storage profile
- Storage (Lyophilized)
- -20°C
- Storage (Reconstituted)
- 2-8°C
- Shelf Life (Lyophilized)
- 24 months at -20°C
- Shelf Life (Reconstituted)
- Up to 28 days at 2-8°C
- Reconstitution
- Bacteriostatic water or sterile water for reconstitution
- Handling
- Store lyophilized powder away from light and moisture. Avoid repeated freeze-thaw cycles after reconstitution. For laboratory research use only.
Shipment
- —1× vial (10 mg)
- —Storage and handling instructions
Studied research areas.
Each item below names a domain in which Thymalin has been investigated in published research. Listed for context — not as a use recommendation.
- 01Investigated in preclinical models for its role in thymic peptide signaling and lymphoid tissue biology
- 02Studied in vitro for effects on lymphocyte differentiation and cellular proliferation pathways
- 03Researched for its role in peptide-mediated regulation of gene expression in cultured cells
- 04Examined in rodent models as a reference compound for thymus-derived polypeptide fraction studies
- 05Used as a comparator in research characterizing short-peptide and oligopeptide signaling mechanisms
- 06Investigated in cellular senescence and aging-related research models in preclinical settings
Held to research-grade quality standards.
Every batch is held to research-grade quality standards before it ships. Each vial is labeled with its batch identifier so that fulfillment can be traced through the order record. For our research-use-only posture, see the Research Compliance page.
Common questions for Thymalin.
For research use only. Not for human consumption.
These products are not intended to diagnose, treat, cure, or prevent any disease. They are sold strictly as research chemicals for laboratory use.
Fulfillment: Orders ship from Texas via USPS within 2 weeks of payment confirmation. You'll receive tracking by email when your package leaves our facility.
Researcher reviews
Reviews open as orders are delivered.
Only researchers who've received an order of this compound can submit a review. Submitted text is screened for compliant language before publication. No anonymous testimonials, no AI-generated copy.
Pending researcher reviews
Reviews appear here as researchers complete and verify orders.
If you've received this compound and would like to leave a review, the option appears in your account dashboard once your order ships.
Reference reading on Thymalin and adjacent topics.
- 6 min
Cold-Chain Logistics for Research Peptide Shipping
Lyophilized peptide stability at room temperature
How long lyophilized research peptides actually tolerate room temperature, why the answer depends on the sequence, and what the published stability literature says about real worst-case shipping exposures.
- 11 min
Foundational
What ≥99% Purity Actually Means: HPLC Explained
A deep technical reference on what HPLC actually measures, how peptide purity is calculated, why ≥99% is the working threshold, and what falls below it.
- 6 min
How to Read a Certificate of Analysis
How to request and verify a COA before you buy
A practical workflow for requesting a Certificate of Analysis from a research peptide vendor, evaluating the response, and confirming the document references the specific batch you would be receiving.
Related Research Products
KPV
10 mg · Immune
KPV
10 mg
KPV is a tripeptide fragment derived from the alpha-melanocyte stimulating hormone (α-MSH) peptide sequence. In labor...
Chonluten
20 mg · Immune
Chonluten
20 mg
Chonluten is a synthetic tripeptide (Glu-Asp-Gly) that has been the subject of research into respiratory tissue gene...
LL-37
5 mg · Immune
LL-37
5 mg
LL-37 is a synthetic 37-residue cationic antimicrobial peptide ([LL-37, 37 aa]), the sole huma...
Thymosin Alpha-1
5 mg · Immune
Thymosin Alpha-1
5 mg
Thymosin Alpha-1 is a synthetic 28-amino-acid, N-terminally acetylated peptide (Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN) that...