LL-37
LL-37
Research this compound
For research use only. Not for human consumption.
Identity, storage, and what ships.
The technical record. Identity rows reflect literature-cited values for this compound; storage rows describe the conditions under which Nexara holds and ships the lyophilized form.
Identity
- Appearance
- White to off-white lyophilized powder
- Molecular Formula
- C205H340N60O53
- Molecular Weight
- 4493.34 g/mol
- CAS Number
- 154947-66-7
- Sequence
- [LL-37, 37 aa]
- Synonyms
- Cathelicidin antimicrobial peptide, hCAP18 (134-170), CAP-18 fragment, Cathelicidin LL-37, Antimicrobial peptide LL-37
- Purity
- ≥99%
Storage profile
- Storage (Lyophilized)
- -20C
- Storage (Reconstituted)
- 2-8C
- Shelf Life (Lyophilized)
- 24 months
- Shelf Life (Reconstituted)
- Use within 30 days
- Reconstitution
- Bacteriostatic water
- Handling
- Protect from light and minimize freeze-thaw cycles. Store lyophilized powder at -20C for long-term stability; reconstituted material should be kept refrigerated at 2-8C.
Shipment
- —1× vial (5 mg)
- —Storage and handling instructions
Studied research areas.
Each item below names a domain in which LL-37 has been investigated in published research. Listed for context — not as a use recommendation.
- 01Membrane-disruption and bacterial-membrane interaction mechanism research
- 02Innate-immune signaling and host-defense pathway studies
- 03Chemotaxis and immune-cell migration assay models
- 04Inflammation-modulation and cytokine-response research
- 05TLR (Toll-like receptor) signaling interaction studies
- 06Peptide alpha-helical structure and lipid-bilayer modeling research
Held to research-grade quality standards.
Every batch is held to research-grade quality standards before it ships. Each vial is labeled with its batch identifier so that fulfillment can be traced through the order record. For our research-use-only posture, see the Research Compliance page.
Common questions for LL-37.
For research use only. Not for human consumption.
These products are not intended to diagnose, treat, cure, or prevent any disease. They are sold strictly as research chemicals for laboratory use.
Fulfillment: Orders ship from Texas via USPS within 2 weeks of payment confirmation. You'll receive tracking by email when your package leaves our facility.
Researcher reviews
Reviews open as orders are delivered.
Only researchers who've received an order of this compound can submit a review. Submitted text is screened for compliant language before publication. No anonymous testimonials, no AI-generated copy.
Pending researcher reviews
Reviews appear here as researchers complete and verify orders.
If you've received this compound and would like to leave a review, the option appears in your account dashboard once your order ships.
Reference reading on LL-37 and adjacent topics.
- 4 min
Foundational
Melanocortin-System Peptides: A Research Overview
How the melanocortin peptide class is studied: PT-141 and Melanotan-2, the melanocortin receptor family (MC1R–MC5R) they act on, and what the receptor-signaling literature examines.
- 6 min
What ≥99% Purity Actually Means: HPLC Explained
Common HPLC artifacts and what impurity peaks mean
How to identify the synthesis origin of common impurity peaks on an HPLC chromatogram, distinguish artifacts from real impurities, and interpret what specific patterns reveal about a batch.
- 6 min
Mass Spectrometry, HPLC, and LAL Endotoxin Testing
What a clean mass spec spectrum looks like
How to interpret an ESI-MS spectrum on a peptide COA: what a clean charge-state envelope looks like, how deconvolution produces the molecular weight, and which spectral anomalies are diagnostic of synthesis or sample problems.
Related Research Products
KPV
10 mg · Immune
KPV
10 mg
KPV is a tripeptide fragment derived from the alpha-melanocyte stimulating hormone (α-MSH) peptide sequence. In labor...
Chonluten
20 mg · Immune
Chonluten
20 mg
Chonluten is a synthetic tripeptide (Glu-Asp-Gly) that has been the subject of research into respiratory tissue gene...
Thymalin
10 mg · Immune
Thymalin
10 mg
Thymalin is a thymus-derived polypeptide fraction that has been the subject of research into thymic peptide signaling...
Thymosin Alpha-1
5 mg · Immune
Thymosin Alpha-1
5 mg
Thymosin Alpha-1 is a synthetic 28-amino-acid, N-terminally acetylated peptide (Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN) that...