KPV
KPV
Strength
Research this compound
For research use only. Not for human consumption.
Identity, storage, and what ships.
The technical record. Identity rows reflect literature-cited values for this compound; storage rows describe the conditions under which Nexara holds and ships the lyophilized form.
Identity
- Appearance
- White lyophilized powder
- Molecular Formula
- C16H30N4O4
- Molecular Weight
- 342.44 g/mol
- CAS Number
- 67727-97-3
- Sequence
- Lys-Pro-Val
- Synonyms
- α-MSH(11-13)
- Purity
- ≥99%
Storage profile
- Storage (Lyophilized)
- -20°C (long-term), 2-8°C up to 30 days (short-term)
- Storage (Reconstituted)
- 2-8°C
- Shelf Life (Lyophilized)
- 24 months at -20°C
- Shelf Life (Reconstituted)
- Up to 28 days at 2-8°C
- Reconstitution
- Bacteriostatic water (0.9% benzyl alcohol) for research reconstitution
- Handling
- Protect from direct light. Avoid repeated freeze-thaw cycles.
Shipment
- —1x lyophilized vial (10mg)
- —Certificate of Analysis (COA)
- —Proper storage instructions
Studied research areas.
Each item below names a domain in which KPV has been investigated in published research. Listed for context — not as a use recommendation.
- 01Inflammatory cytokine modulation research (IL-6, TNF-α pathways)
- 02Intestinal barrier function and mucosal immunology studies
- 03NF-κB signaling pathway investigation
- 04Immune response regulation in preclinical models
- 05Gut-immune axis and mucosal inflammation research
Held to research-grade quality standards.
Every batch is held to research-grade quality standards before it ships. Each vial is labeled with its batch identifier so that fulfillment can be traced through the order record. For our research-use-only posture, see the Research Compliance page.
Common questions for KPV.
For research use only. Not for human consumption.
These products are not intended to diagnose, treat, cure, or prevent any disease. They are sold strictly as research chemicals for laboratory use.
Fulfillment: Orders ship from Texas via USPS within 2 weeks of payment confirmation. You'll receive tracking by email when your package leaves our facility.
Researcher reviews
Reviews open as orders are delivered.
Only researchers who've received an order of this compound can submit a review. Submitted text is screened for compliant language before publication. No anonymous testimonials, no AI-generated copy.
Pending researcher reviews
Reviews appear here as researchers complete and verify orders.
If you've received this compound and would like to leave a review, the option appears in your account dashboard once your order ships.
Reference reading on KPV and adjacent topics.
- 3 min
Compound profile
KPV: Compound Profile
A research profile of KPV, the C-terminal tripeptide of α-MSH (Lys-Pro-Val): identity, the anti-inflammatory mechanism, and what the cytokine and intestinal-barrier literature studies.
- 6 min
Foundational
Tissue-Repair & Regenerative Peptides: A Research Overview
How the tissue-repair peptide class is studied in research: BPC-157, TB-500, and GHK-Cu, their molecular targets, what preclinical work examines, and how they differ.
- 6 min
Cold-Chain Logistics for Research Peptide Shipping
How quickly do reconstituted peptides degrade?
In-solution degradation timelines for reconstituted research peptides: typical shelf-life ranges, the dominant degradation pathways, and the practical consequences for storage and aliquoting practice.
Related Research Products
Chonluten
20 mg · Immune
Chonluten
20 mg
Chonluten is a synthetic tripeptide (Glu-Asp-Gly) that has been the subject of research into respiratory tissue gene...
LL-37
5 mg · Immune
LL-37
5 mg
LL-37 is a synthetic 37-residue cationic antimicrobial peptide ([LL-37, 37 aa]), the sole huma...
Thymalin
10 mg · Immune
Thymalin
10 mg
Thymalin is a thymus-derived polypeptide fraction that has been the subject of research into thymic peptide signaling...
Thymosin Alpha-1
5 mg · Immune
Thymosin Alpha-1
5 mg
Thymosin Alpha-1 is a synthetic 28-amino-acid, N-terminally acetylated peptide (Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN) that...